Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim06g050160.0.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 654aa    MW: 74495.6 Da    PI: 5.3591
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim06g050160.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         r+k ++++++q++eLe++++kn++ps+++r+e+A+kl+++ +qV++WFqN+R+++k
                         7888999**********************************************998 PP

               START   5 eaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.......dsgealrasgvvdmvlallveellddkeqWdetla....kae 80 
                         +a +el+++ + + p+W +      e++n +e+ + f +          +++e  ras +v ++++ lv+ l+d++ qW  +++    k  
                         677899999999******999777766666666665544..1447789999*************************.*********88888 PP

               START  81 tlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskv 164
                          ++vis+g      + l l+++e+q +s lv+ R++ f+R+++++ +++w+ivdvS+d+ ++         +++lpSg++++++++g +kv
                         8899*****************************************************98766.........779***************** PP

               START 165 twvehvdlkgrlphwllrslvksglaegaktwvatlqrq 203
                         tw+eh++++++l+h+ +rsl+k g+a+ga++w a lqrq
                         *************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.35844104IPR001356Homeobox domain
SMARTSM003897.7E-1645108IPR001356Homeobox domain
PfamPF000462.0E-1647102IPR001356Homeobox domain
CDDcd000861.08E-1647105No hitNo description
PROSITE patternPS00027079102IPR017970Homeobox, conserved site
PROSITE profilePS5084830.043174401IPR002913START domain
CDDcd088754.16E-87180396No hitNo description
SuperFamilySSF559614.81E-23181395No hitNo description
SMARTSM002341.2E-28183398IPR002913START domain
PfamPF018524.4E-34188395IPR002913START domain
SuperFamilySSF559613.11E-7420647No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 654 aa     Download sequence    Send to blast
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755180.0HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015078685.10.0PREDICTED: homeobox-leucine zipper protein ROC5-like
RefseqXP_015078684.10.0PREDICTED: homeobox-leucine zipper protein ROC5-like
TrEMBLK4C5G20.0K4C5G2_SOLLC; Uncharacterized protein
STRINGSolyc06g050160.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.11e-165HD-ZIP family protein